collect the videos you love
collect | share | explore
Tag results for surface
sort by: relevance | recent
Results from all user's collections (278 out of ~278)
computational hydrographic printing siggraph 2015

by yizhong zhang chunji yin changxi zheng and kun zhoutechnical paper at acm siggraph 2015abstract:hydrographic printing is a well-known technique in industry for transferring color inks on a thin film to the surface of a manufactured 3d object it enables high-quality coloring of object surfaces and works with a wide range of materials but suffers from the inability to accurately register color texture to complex surface geometries thus it is hardly usable by ordinary users with customized shapes and textureswe present computational hydrographic printing a new method that inherits the versatility of traditional hydrographic printing while also enabling precise alignment of surface textures to possibly complex 3d surfaces in particular we propose the first computational model for simulating hydrographic printing pro- cess this simulation enables us to compute a color image to feed into our hydrographic system for precise texture registration we then build a physical hydrographic system upon off-the-shelf hardware integrating virtual simulation object calibration and controlled immersion to overcome the difficulty of handling complex surfaces we further extend our method to enable multiple immersions each with a different object orientation so the combined colors of individual immersions form a desired texture on the object surface we validate the accuracy of our computational model through physical experiments and demonstrate the efficacy and robustness of our system using a variety of objects with complex surface textures
electromagnetic railgun firing hypervelocity projectile mach 7

watch hyper velocity projectile hvp being demonstrated at us navy039s research labsthe hvp is a next-generation common low drag guided projectile capable of completing multiple missions for gun systems such as the navy 5-inch 155-mm and future railguns types of missions performed will depend on gun system and platform the program goal is to address mission requirements in the areas of naval surface fire support cruise missile defense anti-surface warfare and other future naval mission areas hvps low drag aerodynamic design enables high-velocity maneuverability and decreased time-to-target these attributes coupled with accurate guidance electronics provide low-cost mission effectiveness against current threats and the ability to adapt to air and surface threats of the future wwwonrnavymilenmedia-centerfact-sheetshypervelocity-projectileaspxquotenergetic weapons such as em railguns are the future of naval combatquot said rear adm matt klunder the chief of naval re
hammer vs feather - physics on the moon: galileo and apollo 15

courtesy: nasaat the end of the last apollo 15 moon walk commander david scott pictured above performed a live demonstration for the television cameras he held out a geologic hammer and a feather and dropped them at the same time because they were essentially in a vacuum there was no air resistance and the feather fell at the same rate as the hammer as galileo had concluded hundreds of years before - all objects released together fall at the same rate regardless of mass mission controller joe allen described the demonstration in the quotapollo 15 preliminary science reportquot:during the final minutes of the third extravehicular activity a short demonstration experiment was conducted a heavy object a 132-kg aluminum geological hammer and a light object a 003-kg falcon feather were released simultaneously from approximately the same height approximately 16 m and were allowed to fall to the surface within the accuracy of the simultaneous release the objects were observed to undergo the same acceleration and strike the lunar surface simultaneously which was a result predicted by well-established theory but a result nonetheless reassuring considering both the number of viewers that witnessed the experiment and the fact that the homeward journey was based critically on the validity of the particular theory being testedjoe allen nasa sp-289 apollo 15 preliminary science report summary of scientific results p 2-11 click to subscribe http:bitlysubairboyd
junior walk 21: the coal companies control everything you do

junior walk is an environmental activist who paid a high price for speaking out against the coal industry he was raised in the southern part of west virginia on the banks of the coal river in his community you either take a minimum wage job join the military or work for the coal mining industryhe attended the keystone xl protest in washington in august he was arrested last month at a tree sit-in to stop blasting he039s being sued by his former employer massey energy now alpha natural resources for trespassing his court date is scheduled for november 14junior is in san francisco accepting the brower youth award which is given to seven young people for their outstanding activism and achievements in the fields of environmental and social justice advocacy it039s the first time he039s traveled west of the mississippi find out more here: http:isgdq5rbd2listen to the your call show with junior and two other award recipients: http:isgdydd8az
nutritious pancakes 4 ways

customize amp buy the tasty cookbook here: http:bzfdit2fpfeu5here is what you039ll needbanana pancakesservings: 4ingredients2 large ripe bananas2 eggs1 teaspoon vanilla extract1 teaspoon cinnamonpreparationin a bowl mash bananasmix in the egg then vanilla and cinnamonpour pancake batter in cup amounts on a griddle or skillet over medium-high heatcook until bubbles pop on the surface of the pancake then flip and cook the other sideenjoycinnamon roll pancakesservings: 2ingredients1 egg2 tablespoons milk cup oats teaspoon baking powder cup greek yogurt teaspoon cinnamon1 tablespoon brown sugar1 tablespoon coconut oilpreparationin a blender blend the egg milk oats baking powder and greek yogurtin a squirt bottle combine cinnamon brown sugar and coconut oilon a griddle or pan over medium-high heat pour pancake batter in cup amounts drizzle cinnamon sugar mixture over the pancake when bubbles start to pop on the surface flip and coo
the best selling wireless speaker on amazon

anker soundcore usa link - https:amznto2wvp6t6anker soundcore international - http:geniusbgbqtcqhere it is the best selling wireless bluetooth speaker on amazonwatch some more videosyour iphone has been compromisedhttps:youtube5afkticv2aqis this laptop too quotextremequothttps:youtubedtccegiikxemkbhd picks the best smartphone camerahttps:youtubeh2whify6abycheck out the back of this smartphonehttps:youtube2cqksmzoiyithe iphone xi smartphone powered laptophttps:youtubei0u_pyaqgwythe top wireless earbuds on amazon are only 17https:youtubedtlmjwqzy1qdoes mkbhd like the xiaomi folding phonehttps:youtubeholbprcf8c8you guys asked for weird gadgetshttps:youtuber0lbcetv4xwthe world039s smallest bluetooth speakerhttps:youtubef0u-n3yntpeit039s the best selling smartphone on amazon but whyhttps:youtubetfubcks-87mi039m switching to the oneplus 6thttps:youtubevc6b8klpuxcis the iphone smart batte
galaxy s10 pricing revealed - this could be a problem

is the samsung galaxy s10 galaxy s10 too expensivesupersaf - https:youtubecomsupersafwatch some more videosunboxing the 1300 bluetooth speakerhttps:youtubeijue4uvwvoodave2d says don039t buy these laptopshttps:youtubeeaodw4sjcyilose weight without exercisehttps:youtubek76l9twdfh0oneplus beats iphone in indiahttps:youtubejdxqzw8qgrsthe flashiest smartphone everhttps:youtubep87s4dramradon039t make this airpods mistakehttps:youtube5a8m6illczmthe best selling wireless speaker on amazonhttps:youtuben826ttjwxu4your iphone has been compromisedhttps:youtube5afkticv2aqis this laptop too quotextremequothttps:youtubedtccegiikxemkbhd picks the best smartphone camerahttps:youtubeh2whify6abycheck out the back of this smartphonehttps:youtube2cqksmzoiyithe iphone xi smartphone powered laptophttps:youtubei0u_pyaqgwythe top wireless earbuds on amazon are only 17https:youtubedtlmjwqzy1qdoes mkbhd like th
understanding the magnetic sun

nasa gsfc solar scientist holly gilbert explains a computer model of the suns magnetic fieldgrasping what drives that magnetic system is crucial for understanding the nature of space throughout the solar system: the sun039s invisible magnetic field is responsible for everything from the solar explosions that cause space weather on earth such as auroras to the interplanetary magnetic field and radiation through which our spacecraft journeying around the solar system must travel we can observe the shape of the magnetic fields above the sun039s surface because they guide the motion of that plasma the loops and towers of material in the corona glow brightly in euv images additionally the footpoints on the suns surface or photosphere of these magnetic loops can be more precisely measured using an instrument called a magnetograph which measures the strength and direction of magnetic fields scientists also turn to models they combine their observations measurements of the magnetic field strength and direction on the solar surface with an understanding of how solar material moves and magnetism to fill in the gaps simulations such as the potential field source surface or pfss model shown in the accompanying video can help illustrate exactly how magnetic fields undulate around the sun models like pfss can give us a good idea of what the solar magnetic field looks like in the suns corona and even on the suns far side download other resolutions from our scientific visualization studio: http:svsgsfcnasagovcgi-bindetailscgiaid=12104read more at: http:wwwnasagovfeaturegoddard2016understanding-the-magnetic-sunscience paper: photospheric and heliospheric magnetic fields by carolus j schrijver and marc l de rosa original visualization: http:svsgsfcnasagovgoto4391
fuji cp-643 chip shooter 500 placements

better vid better boardcreative hi-tech ltd710 cooper ctschaumburg il 60173224-653-4000
color changing milk experiment - science projects for kids educational videos by mocomi

can colours explode in milk - colour changing milk science experiment for kidsrequirements:-a quarter platemilkfood colour 2-3 variantsa cotton swabliquid detergent what to do:-pour some milk into the quarter plate now add a few drops of the food colour into the bowl close to each other once this is done take the cotton swab and dip it in the liquid detergent and then dab the swab in the middle of any of the colour dropswhat happens:-there is a huge explosion of colour when the swab dipped in liquid soap comes in contact with the added food colour the food colour which was just a few drops when added initially is all over the quarter plate you see a huge fusion of colours and this continues for quite sometimewhy this happens:-milk is made up of water minerals vitamins proteins and tiny droplets of fat soap breaks up the fat globules and weakens the chemical bonds of proteinsthis pushes and pulls the food colouring molecules every which way colours also explod
live texturing of augmented reality characters from colored drawings

link to publication page: http:wwwdisneyresearchcompublicationlive-texturing-of-augmented-reality-characterscoloring books capture the imagination of children and provide them with one of their earliest opportunities for creative expression however given the proliferation and popularity of digital devices real-world activities like coloring can seem unexciting and children become less engaged in them augmented reality holds unique potential to impact this situation by providing a bridge between real-world activities and digital enhancements in this paper we present an augmented reality coloring book app in which children color characters in a printed coloring book and inspect their work using a mobile device the drawing is detected and tracked and the video stream is augmented with an animated 3-d version of the character that is textured according to the childs coloring this is possible thanks to several novel technical contributions we present a texturing process that applies the captured texture from a 2-d colored drawing to both the visible and occluded regions of a 3-d character in real time we develop a deformable surface tracking method designed for colored drawings that uses a new outlier rejection algorithm for real-time tracking and surface deformation recovery we present a content creation pipeline to efficiently create the 2-d and 3-d content and finally we validate our work with two user studies that examine the quality of our texturing algorithm and the overall app experience
beagle 2 found on mars

the uk-led beagle 2 was due to land on mars on 25 december 2003 the spacecraft was ejected from mars express on 19 december 2003 nothing had been heard from beagle 2 and the mission was presumed lost until nowit has now been announced that the mars lander has been identified partially deployed on the surface of mars by images taken by the hirise camera on nasas mars reconnaissance orbiter mro these images show potential targets on the surface of mars for the lander and key entry and descent components within the expected landing areafollowing analysis by members of the beagle 2 team which includes leicester scientists and nasa the images show the beagle 2 lander in what appears to be a partially deployed configuration with the main parachute and what is thought to be the rear cover close by several interpretations of the image of the lander have been identified consistent with the landers size and shape and changes in light reflections suggest that the object is metallic again consistent with beagle 2professor colin pillinger from the open university who died in may 2014 led the beagle 2 project along with colleagues from our department of physics and astronomy another major contributor professor george fraser and director of the space research centre at the university also passed away in 2014
what about a mission to titan

europa is fine and all but where we really need to go is saturn039s moon titan let039s look at some cool ideas for probes to fully explore this worldsupport us at: http:wwwpatreoncomuniversetodaymore stories at: http:wwwuniversetodaycomfollow us on twitter: universetodaylike us on facebook: https:wwwfacebookcomuniversetodaygoogle - https:plusgooglecomuniversetodayinstagram - http:instagramcomuniversetodayteam: fraser cain - fcain frasercaingmailcomkarla thompson - karlaiichad weber - weberchadgmailcomas you probably know nasa recently announced plans to send a mission to jupiters moon europa if all goes well the europa clipper will blast off for the world in the 2020s and orbit the icy moon to discover all its secrets and thats great and all i like europa just fine but you know where id really like us to go next titantitan as you probably know is the largest moon orbiting saturn in fact its the second largest moon in the s
multiple milia under the eyes

this young beautiful woman has many milia under her eyes these are very difficult to remove on your own skin because they can039t really be squeezed out without first nicking the surface of the skin first also the skin under the eyes is very thin and its difficult to squeeze the area with your own fingers you will see it039s not that easy to use an extractor - it039s important to push against the orbital bone away from the eye socket to successfully extract these stubborn bumpsa milium single for milia is a small superficial cyst formed in the top layer of the skin called the epidermis they appear as tiny pearly-white bumps just under the surface of the skin they contain keratin skin protein and are harmless they are often seen on the face in particular on the delicate skin around the eyes they can be prevented or minimized with exfoliating like chemical peels microdermabrasion or topical retinoids however they are sometimes difficult to remove without a physicians help since they cannot simply be squeezed out often the surface of the skin has to be pierced first with a lancet a sharp pointed blade or a needle in order to successfully remove the milium often a comedone extractor is used to express the milium thank you for watchingsubscribe to my dermatology educational channel dr pimple popper university link is here: https:wwwyoutubecomchannelucvad01jb_ruxsacvqvmthzqfor more content exclusive content and of course to get your dr pimple popper schwag visit us at wwwdrpimplepoppercominstagram: drpimplepopper for 247 pops drsandralee for my work my life my popsfacebook: facebookcomdrsandraleedermatologytwitter: sandraleemdsnapchat: drpimplepopperperiscope: dr sandra leeyou can watch my tv appearances here: https:wwwyoutubecomchannelucoixdrvqaske4stsuwu8u0qthis video may contain dermatologic surgical andor procedural content the content seen in this video is provided only for medical education purposes and is not intended to be a substitute for professional medical advice diagnosis or treatment
i039m switching to the oneplus 6t

it039s that time again i039m switching from the samsung galaxy note 9 to the oneplus 6t mclaren edition let039s see how this goeswatch some more videosis the iphone smart battery case worth the pricehttps:youtubeujj33ohpdcqi039ve got some bad newshttps:youtube4qdsqwkuvxqswitching to iphone could save your lifehttps:youtube7wn0ildqulmthis is not a laptophttps:youtubewa-ugf9rmmgcould this actually be the iphone 11https:youtube_hrdknrbpiqcancel save changes can you spot the hidden techhttps:youtube9wjgk99x-mcthe foldable smartphone you can buy right nowhttps:youtubemgmglmrbbugapple airpods buyers need to see thishttps:youtubevshzxse_zn4the redmi note 7 could be smartphone value championhttps:youtubemwiemk1pg_ka different kind of smartphonehttps:youtubelgl7pjxy6y8humans are physically attacking self-driving carshttps:youtubewe5jor8djayhere039s what a 5500 smartphone looks likehttps:youtub